DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DOG-1.1, Concentrate, 0.5 mL

DOG-1 / TMEM16A (Marker for Gastrointestinal Stromal Tumors); Clone DOG-1.1 (Concentrate), 0.5 mL.

• Species: Mouse
• Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
• Clone: DOG-1.1
• Isotype: IgG1, kappa
• Species Reactivity: Human. Others not known.
• Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.

Specificity: DOG1.1 is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. DOG1.1 is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations. Status: RUO.

• Volume: 0.5 mL
• Storage: 2°C- 8°C
• Download: Instructions For Use
• MSDS: Material Safety Data Sheet

Antibodies > Research Antibodies > Monoclonal Concentrate

Contact us for bulk order inquiries, custom packaging, blanket orders, and other special orders.

Terms & Conditions

These chemicals are for professional manufacturing, research laboratories and industrial / commercial usage only. Not for medical or consumer use. We currently cannot ship this product to doctor offices, pharmacies, medical facilities, veterinarians or residences. All orders are verified prior to shipment. Orders shipping to consumers or medical facilities will be canceled.

Please note: This product is not returnable. Chemicals cannot be expedited.